PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.2003s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 309aa    MW: 34256.2 Da    PI: 8.3384
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.2003s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.6e-32217270255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Kalax.2003s0001.1.p 217 PRMRWTNSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 270
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.99E-16214271IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-29215271IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-24217270IPR006447Myb domain, plants
PfamPF002493.0E-7218269IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MPINSQRNTE MVAPDLDLHI CLPNMVASPS SVSSASLYCH EEPDTELSLL PNSSSETDNL  60
WSRQQQQQKP SSLNTLGLDE AAKNHNKQSL RFCPSFRSVR QAITANNTDQ QYVSGEGRNS  120
KLIKGIPVYN QSSSASSLYS NNPNFGGALR LNGMPMEAIR KQQPQFRYCS SSHQYSGIAG  180
QSSHSSIGVP EVNGDIVFRP RFMLPKIQDR RNNVRAPRMR WTNSLHARFV HAVELLGGHE  240
RATPKSVLEL MDVKDLTLAH VKSHLQMYRT VKSTDRSAAS SDGFGDEVFS RMEESIGSFS  300
GEREIAQD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006376702.11e-51hypothetical protein POPTR_0012s03900g
SwissprotQ93WJ93e-42KAN1_ARATH; Transcription repressor KAN1
TrEMBLU5FWI51e-51U5FWI5_POPTR; Uncharacterized protein
STRINGPOPTR_0012s03900.13e-51(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-42G2-like family protein